Lineage for d1nofa1 (1nof A:31-43,A:321-413)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804045Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1804046Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1804458Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
    interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain
  6. 1804569Protein Glycosyl hydrolase family 5 xylanase [101922] (1 species)
  7. 1804570Species Erwinia chrysanthemi [TaxId:556] [101923] (2 PDB entries)
  8. 1804572Domain d1nofa1: 1nof A:31-43,A:321-413 [92020]
    Other proteins in same PDB: d1nofa2
    complexed with act

Details for d1nofa1

PDB Entry: 1nof (more details), 1.42 Å

PDB Description: the first crystallographic structure of a xylanase from glycosyl hydrolase family 5: implications for catalysis
PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d1nofa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nofa1 b.71.1.2 (A:31-43,A:321-413) Glycosyl hydrolase family 5 xylanase {Erwinia chrysanthemi [TaxId: 556]}
dtvkidanvnyqiXgalriqatenpqsnvhltaykntdgkmvivavntndsdqmlslnis
nanvtkfekystsaslnveyggssqvdssgkatvwlnplsvttfvsk

SCOPe Domain Coordinates for d1nofa1:

Click to download the PDB-style file with coordinates for d1nofa1.
(The format of our PDB-style files is described here.)

Timeline for d1nofa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nofa2