![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
![]() | Family g.41.5.1: Rubredoxin [57803] (5 proteins) |
![]() | Protein Rubrerythrin, C-terminal domain [57811] (2 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [103622] (2 PDB entries) |
![]() | Domain d1nnqb2: 1nnq B:135-171 [92009] Other proteins in same PDB: d1nnqa1, d1nnqb1 structural genomics complexed with zn |
PDB Entry: 1nnq (more details), 2.35 Å
SCOPe Domain Sequences for d1nnqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nnqb2 g.41.5.1 (B:135-171) Rubrerythrin, C-terminal domain {Pyrococcus furiosus [TaxId: 2261]} eikkvyicpicgytavdeapeycpvcgapkekfvvfe
Timeline for d1nnqb2: