Lineage for d1nnqb2 (1nnq B:135-171)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 430156Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 430253Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 430254Family g.41.5.1: Rubredoxin [57803] (3 proteins)
  6. 430307Protein Rubrerythrin, C-terminal domain [57811] (2 species)
  7. 430308Species Archaeon Pyrococcus furiosus [TaxId:2261] [103622] (1 PDB entry)
  8. 430310Domain d1nnqb2: 1nnq B:135-171 [92009]
    Other proteins in same PDB: d1nnqa1, d1nnqb1
    structural genomics
    complexed with zn

Details for d1nnqb2

PDB Entry: 1nnq (more details), 2.35 Å

PDB Description: rubrerythrin from pyrococcus furiosus pfu-1210814

SCOP Domain Sequences for d1nnqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nnqb2 g.41.5.1 (B:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus}
eikkvyicpicgytavdeapeycpvcgapkekfvvfe

SCOP Domain Coordinates for d1nnqb2:

Click to download the PDB-style file with coordinates for d1nnqb2.
(The format of our PDB-style files is described here.)

Timeline for d1nnqb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nnqb1