Lineage for d1nnqb2 (1nnq B:135-171)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036508Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 3036509Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 3036621Protein Rubrerythrin, C-terminal domain [57811] (2 species)
  7. 3036633Species Pyrococcus furiosus [TaxId:2261] [103622] (2 PDB entries)
  8. 3036637Domain d1nnqb2: 1nnq B:135-171 [92009]
    Other proteins in same PDB: d1nnqa1, d1nnqb1
    structural genomics
    complexed with zn

Details for d1nnqb2

PDB Entry: 1nnq (more details), 2.35 Å

PDB Description: rubrerythrin from pyrococcus furiosus pfu-1210814
PDB Compounds: (B:) rubrerythrin

SCOPe Domain Sequences for d1nnqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nnqb2 g.41.5.1 (B:135-171) Rubrerythrin, C-terminal domain {Pyrococcus furiosus [TaxId: 2261]}
eikkvyicpicgytavdeapeycpvcgapkekfvvfe

SCOPe Domain Coordinates for d1nnqb2:

Click to download the PDB-style file with coordinates for d1nnqb2.
(The format of our PDB-style files is described here.)

Timeline for d1nnqb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nnqb1