SCOPe 2.01: Domain d1nnqb1: 1nnq B:2-134

Lineage for d1nnqb1 (1nnq B:2-134)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Rubrerythrin, N-terminal domain [47242] (2 species)

7. Species Pyrococcus furiosus [TaxId:2261] [101129] (2 PDB entries)

8. Domain d1nnqb1: 1nnq B:2-134 [92008]
   Other proteins in same PDB: d1nnqa2, d1nnqb2
   structural genomics
   complexed with zn

Details for d1nnqb1

PDB Entry: 1nnq, 2.35 Å

PDB Description: rubrerythrin from pyrococcus furiosus pfu-1210814

PDB Compounds: (B:) rubrerythrin

SCOPe Domain Sequences for d1nnqb1:

Sequence; same for both SEQRES and ATOM records:

>d1nnqb1 a.25.1.1 (B:2-134) Rubrerythrin, N-terminal domain {Pyrococcus furiosus [TaxId: 2261]}
vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
rkakekaekgedi

Timeline for d1nnqb1:

• d1nnqb1 first appeared in SCOP 1.67
  
• d1nnqb1 appears in SCOP 1.75
  
• d1nnqb1 appears in SCOPe 2.02
  
• d1nnqb1 appears in the current release, SCOPe 2.08