![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein Rubrerythrin, N-terminal domain [47242] (2 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [101129] (2 PDB entries) |
![]() | Domain d1nnqb1: 1nnq B:2-134 [92008] Other proteins in same PDB: d1nnqa2, d1nnqb2 structural genomics complexed with zn |
PDB Entry: 1nnq (more details), 2.35 Å
SCOPe Domain Sequences for d1nnqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nnqb1 a.25.1.1 (B:2-134) Rubrerythrin, N-terminal domain {Pyrococcus furiosus [TaxId: 2261]} vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely rkakekaekgedi
Timeline for d1nnqb1: