Lineage for d1nnqa2 (1nnq A:135-171)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892941Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 893109Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 893110Family g.41.5.1: Rubredoxin [57803] (4 proteins)
  6. 893182Protein Rubrerythrin, C-terminal domain [57811] (2 species)
  7. 893183Species Archaeon Pyrococcus furiosus [TaxId:2261] [103622] (2 PDB entries)
  8. 893184Domain d1nnqa2: 1nnq A:135-171 [92007]
    Other proteins in same PDB: d1nnqa1, d1nnqb1
    structural genomics

Details for d1nnqa2

PDB Entry: 1nnq (more details), 2.35 Å

PDB Description: rubrerythrin from pyrococcus furiosus pfu-1210814
PDB Compounds: (A:) rubrerythrin

SCOP Domain Sequences for d1nnqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}
eikkvyicpicgytavdeapeycpvcgapkekfvvfe

SCOP Domain Coordinates for d1nnqa2:

Click to download the PDB-style file with coordinates for d1nnqa2.
(The format of our PDB-style files is described here.)

Timeline for d1nnqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nnqa1