| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (3 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (7 proteins) |
| Protein Rubrerythrin, N-terminal domain [47242] (2 species) |
| Species Archaeon Pyrococcus furiosus [TaxId:2261] [101129] (1 PDB entry) |
| Domain d1nnqa1: 1nnq A:2-134 [92006] Other proteins in same PDB: d1nnqa2, d1nnqb2 |
PDB Entry: 1nnq (more details), 2.35 Å
SCOP Domain Sequences for d1nnqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nnqa1 a.25.1.1 (A:2-134) Rubrerythrin, N-terminal domain {Archaeon Pyrococcus furiosus}
vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
rkakekaekgedi
Timeline for d1nnqa1: