Lineage for d1nnqa1 (1nnq A:2-134)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 441060Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 441061Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 441062Family a.25.1.1: Ferritin [47241] (7 proteins)
  6. 441406Protein Rubrerythrin, N-terminal domain [47242] (2 species)
  7. 441407Species Archaeon Pyrococcus furiosus [TaxId:2261] [101129] (1 PDB entry)
  8. 441408Domain d1nnqa1: 1nnq A:2-134 [92006]
    Other proteins in same PDB: d1nnqa2, d1nnqb2

Details for d1nnqa1

PDB Entry: 1nnq (more details), 2.35 Å

PDB Description: rubrerythrin from pyrococcus furiosus pfu-1210814

SCOP Domain Sequences for d1nnqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nnqa1 a.25.1.1 (A:2-134) Rubrerythrin, N-terminal domain {Archaeon Pyrococcus furiosus}
vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
rkakekaekgedi

SCOP Domain Coordinates for d1nnqa1:

Click to download the PDB-style file with coordinates for d1nnqa1.
(The format of our PDB-style files is described here.)

Timeline for d1nnqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nnqa2