![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein) duplication: contains two cytochrome c-type domains |
![]() | Protein Di-heme cytochrome c peroxidase [46686] (3 species) |
![]() | Species Pseudomonas nautica [TaxId:2743] [100993] (3 PDB entries) Uniprot P83787 |
![]() | Domain d1nmla1: 1nml A:1-166 [91976] complexed with cit, hem |
PDB Entry: 1nml (more details), 2.2 Å
SCOPe Domain Sequences for d1nmla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nmla1 a.3.1.5 (A:1-166) Di-heme cytochrome c peroxidase {Pseudomonas nautica [TaxId: 2743]} dnlmeransmfepipkyppvidgneltqakvelgkmeffeprlssshliscntchnvglg gddelptsighgwqkgprnsptvfnavfnaaqfwdgraadlaeqakgpvqagvemsstpd rvvatlksmpeyierfedafpgqenpvtfdnmavaieayeatlitp
Timeline for d1nmla1: