Lineage for d1nl0l2 (1nl0 L:109-210)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2360924Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 2360928Species Human (Homo sapiens) [TaxId:9606] [88572] (47 PDB entries)
  8. 2360949Domain d1nl0l2: 1nl0 L:109-210 [91948]
    Other proteins in same PDB: d1nl0g_, d1nl0h1, d1nl0h2, d1nl0l1
    part of Fab 10c12 against factor IX Gla domain
    complexed with ca, so4

Details for d1nl0l2

PDB Entry: 1nl0 (more details), 2.2 Å

PDB Description: Crystal structure of human factor IX Gla domain in complex of an inhibitory antibody, 10C12
PDB Compounds: (L:) anti-factor IX antibody, 10C12, chain L

SCOPe Domain Sequences for d1nl0l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nl0l2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvapt

SCOPe Domain Coordinates for d1nl0l2:

Click to download the PDB-style file with coordinates for d1nl0l2.
(The format of our PDB-style files is described here.)

Timeline for d1nl0l2: