SCOPe 2.01: Domain d1nl0l1: 1nl0 L:1-108

Lineage for d1nl0l1 (1nl0 L:1-108)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88536] (10 PDB entries)

8. Domain d1nl0l1: 1nl0 L:1-108 [91947]
   Other proteins in same PDB: d1nl0g_, d1nl0h1, d1nl0h2, d1nl0l2
   part of Fab 10c12 against factor IX Gla domain
   complexed with ca, so4

Details for d1nl0l1

PDB Entry: 1nl0, 2.2 Å

PDB Description: Crystal structure of human factor IX Gla domain in complex of an inhibitory antibody, 10C12

PDB Compounds: (L:) anti-factor IX antibody, 10C12, chain L

SCOPe Domain Sequences for d1nl0l1:

Sequence; same for both SEQRES and ATOM records:

>d1nl0l1 b.1.1.1 (L:1-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
qsvltqppsvsaapgqkvtiscsgstsnignnyvswyqqhpgkapklmiydvskrpsgvp
drfsgsksgnsasldisglqsedeadyycaawddslseflfgtgtkltvlg

Timeline for d1nl0l1:

• d1nl0l1 first appeared in SCOP 1.67
  
• d1nl0l1 appears in SCOP 1.75
  
• d1nl0l1 appears in SCOPe 2.02
  
• d1nl0l1 appears in the current release, SCOPe 2.08