SCOP 1.69: Domain d1nl0h2: 1nl0 H:114-217

Lineage for d1nl0h2 (1nl0 H:114-217)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (82 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1nl0h2: 1nl0 H:114-217 [91946]
   Other proteins in same PDB: d1nl0g_, d1nl0h1, d1nl0l1, d1nl0l2
   part of Fab 10c12 against factor IX Gla domain

Details for d1nl0h2

PDB Entry: 1nl0, 2.2 Å

PDB Description: Crystal structure of human factor IX Gla domain in complex of an inhibitory antibody, 10C12

SCOP Domain Sequences for d1nl0h2:

Sequence, based on SEQRES records:

>d1nl0h2 b.1.1.2 (H:114-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd

Sequence, based on observed residues (ATOM records):

>d1nl0h2 b.1.1.2 (H:114-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
vtvpssslgtqtyicnvnhkpsntkvdkkvepkscd

Timeline for d1nl0h2:

• d1nl0h2 first appeared in SCOP 1.67
  
• d1nl0h2 appears in SCOP 1.71
  
• d1nl0h2 appears in the current release, SCOPe 2.08