Lineage for d1njza1 (1njz A:297-468)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 586646Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) (S)
    consists of one domain of this fold
  5. 586884Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (10 proteins)
    contains Pfam 00929
  6. 586925Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 586926Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (32 PDB entries)
  8. 586949Domain d1njza1: 1njz A:297-468 [91919]
    Other proteins in same PDB: d1njza2
    complexed with mg, so4, suc

Details for d1njza1

PDB Entry: 1njz (more details), 2 Å

PDB Description: cytosine-thymine mismatch at the polymerase active site

SCOP Domain Sequences for d1njza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njza1 c.55.3.5 (A:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed}
akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

SCOP Domain Coordinates for d1njza1:

Click to download the PDB-style file with coordinates for d1njza1.
(The format of our PDB-style files is described here.)

Timeline for d1njza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1njza2