![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
![]() | Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) ![]() the barrel is decorated with additional structures |
![]() | Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins) barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel |
![]() | Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species) |
![]() | Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [50628] (5 PDB entries) Uniprot P07805 |
![]() | Domain d1njjc1: 1njj C:14-43,C:284-409 [91909] Other proteins in same PDB: d1njja2, d1njjb2, d1njjc2, d1njjd2 complexed with get, orx |
PDB Entry: 1njj (more details), 2.45 Å
SCOPe Domain Sequences for d1njjc1:
Sequence, based on SEQRES records: (download)
>d1njjc1 b.49.2.3 (C:14-43,C:284-409) Eukaryotic ornithine decarboxylase (ODC) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} rflegfntrdalckkismntcdegdpffvaXftlavnviakkvtpgvqtdvgahaesnaq sfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptcdgldqiveryyl pemqvgewllfedmgaytvvgtssfngfqsptiyyvv
>d1njjc1 b.49.2.3 (C:14-43,C:284-409) Eukaryotic ornithine decarboxylase (ODC) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} rflegfntrdalckkgdpffvaXftlavnviakkvtqsfmyyvndgvygsfncilydhav vrplpqrepieklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvsptiy yvv
Timeline for d1njjc1: