SCOPe 2.06: Domain d1njjb1: 1njj B:20-43,B:284-409

Lineage for d1njjb1 (1njj B:20-43,B:284-409)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families)
   the barrel is decorated with additional structures

5. Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
   barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel

6. Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species)

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [50628] (5 PDB entries)
   Uniprot P07805

8. Domain d1njjb1: 1njj B:20-43,B:284-409 [91907]
   Other proteins in same PDB: d1njja2, d1njjb2, d1njjc2, d1njjd2
   complexed with get, orx

Details for d1njjb1

PDB Entry: 1njj, 2.45 Å

PDB Description: crystal structure determination of t. brucei ornithine decarboxylase bound to d-ornithine and to g418

PDB Compounds: (B:) ornithine decarboxylase

SCOPe Domain Sequences for d1njjb1:

Sequence, based on SEQRES records:

>d1njjb1 b.49.2.3 (B:20-43,B:284-409) Eukaryotic ornithine decarboxylase (ODC) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
ntrdalckkismntcdegdpffvaXftlavnviakkvtpgvqtdvgahaesnaqsfmyyv
ndgvygsfncilydhavvrplpqrepipneklypssvwgptcdgldqiveryylpemqvg
ewllfedmgaytvvgtssfngfqsptiyyvv

Sequence, based on observed residues (ATOM records):

>d1njjb1 b.49.2.3 (B:20-43,B:284-409) Eukaryotic ornithine decarboxylase (ODC) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
ntrdalckkisgdpffvaXftlavnviakkvtqsfmyyvndgvygsfncilydhavvrpl
pqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvsptiyyvv

Timeline for d1njjb1:

• d1njjb1 first appeared in SCOP 1.67
  
• d1njjb1 appears in SCOPe 2.05
  
• d1njjb1 appears in SCOPe 2.07
  
• d1njjb1 appears in the current release, SCOPe 2.08