Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries) |
Domain d1nj9l2: 1nj9 L:109-210 [91904] Other proteins in same PDB: d1nj9a1, d1nj9b1, d1nj9b2, d1nj9h1, d1nj9h2, d1nj9l1 part of cocaine hydrolytic Fab 15a10 complexed with na |
PDB Entry: 1nj9 (more details), 2.35 Å
SCOPe Domain Sequences for d1nj9l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nj9l2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq snnkymassyltltarewerhssyscqvtheghtvekslsra
Timeline for d1nj9l2: