Lineage for d1nj9h1 (1nj9 H:1-113)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450916Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451214Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (143 PDB entries)
  8. 451322Domain d1nj9h1: 1nj9 H:1-113 [91901]
    Other proteins in same PDB: d1nj9a1, d1nj9a2, d1nj9b2, d1nj9h2, d1nj9l1, d1nj9l2
    part of cocaine hydrolytic Fab 15a10

Details for d1nj9h1

PDB Entry: 1nj9 (more details), 2.35 Å

PDB Description: cocaine hydrolytic antibody 15a10

SCOP Domain Sequences for d1nj9h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nj9h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
evqlqqsgpelvkpgasvkvsckasgysftdynmywvkqnhgeslewiayidpsngdtfy
nqkfqgkatvtldkssstafmhlnsltsedsavyycarggglfafwgqgtlvtvsa

SCOP Domain Coordinates for d1nj9h1:

Click to download the PDB-style file with coordinates for d1nj9h1.
(The format of our PDB-style files is described here.)

Timeline for d1nj9h1: