Lineage for d1nj9a2 (1nj9 A:109-210)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 656556Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 656560Species Human (Homo sapiens) [TaxId:9606] [88572] (43 PDB entries)
  8. 656590Domain d1nj9a2: 1nj9 A:109-210 [91898]
    Other proteins in same PDB: d1nj9a1, d1nj9b1, d1nj9b2, d1nj9h1, d1nj9h2, d1nj9l1

Details for d1nj9a2

PDB Entry: 1nj9 (more details), 2.35 Å

PDB Description: cocaine hydrolytic antibody 15a10
PDB Compounds: (A:) immunoglobulin variable chain

SCOP Domain Sequences for d1nj9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nj9a2 b.1.1.2 (A:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarewerhssyscqvtheghtvekslsra

SCOP Domain Coordinates for d1nj9a2:

Click to download the PDB-style file with coordinates for d1nj9a2.
(The format of our PDB-style files is described here.)

Timeline for d1nj9a2: