![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.6: PLP-binding barrel [51419] (2 families) ![]() circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand |
![]() | Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins) |
![]() | Protein Alanine racemase [51421] (3 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [51422] (8 PDB entries) |
![]() | Domain d1niua2: 1niu A:12-244 [91894] Other proteins in same PDB: d1niua1, d1niub1 complexed with dcs |
PDB Entry: 1niu (more details), 2.2 Å
SCOPe Domain Sequences for d1niua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1niua2 c.1.6.1 (A:12-244) Alanine racemase {Bacillus stearothermophilus [TaxId: 1422]} vdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrlavafldeal alrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpfpihfhlkmd tgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqytrflhmlew lpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplkea
Timeline for d1niua2: