SCOPe 2.06: Domain d1nd2a_: 1nd2 A:

Lineage for d1nd2a_ (1nd2 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Rhinovirus coat proteins [49670] (5 species)

7. Species Human rhinovirus 16, (HRV-16) [TaxId:31708] [49672] (9 PDB entries)

8. Domain d1nd2a_: 1nd2 A: [91810]
   complexed with myr, zn

Details for d1nd2a_

PDB Entry: 1nd2, 2.5 Å

PDB Description: The structure of Rhinovirus 16

PDB Compounds: (A:) coat protein vp1

SCOPe Domain Sequences for d1nd2a_:

Sequence; same for both SEQRES and ATOM records:

>d1nd2a_ b.121.4.1 (A:) Rhinovirus coat proteins {Human rhinovirus 16, (HRV-16) [TaxId: 31708]}
npveryvdevlnevlvvpninqshpttsnaapvldaaetghtnkiqpedtietryvqssq
tldemsvesflgrsgcihesvldivdnyndqsftkwninlqemaqirrkfemftyarfds
eitmvpsvaakdghighivmqymyvppgapipttrddyawqsgtnasvfwqhgqpfprfs
lpflsiasayymfydgydgdtyksrygtvvtndmgtlcsrivtseqlhkvkvvtriyhka
khtkawcprppravqyshthttnyklssevhndvairprtnlttv

Timeline for d1nd2a_:

• d1nd2a_ first appeared in SCOP 1.67
  
• d1nd2a_ appears in SCOPe 2.05
  
• d1nd2a_ appears in SCOPe 2.07
  
• d1nd2a_ appears in the current release, SCOPe 2.08