Lineage for d1nc4d2 (1nc4 D:121-220)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655494Domain d1nc4d2: 1nc4 D:121-220 [91796]
    Other proteins in same PDB: d1nc4a1, d1nc4a2, d1nc4b1, d1nc4c1, d1nc4c2, d1nc4d1
    part of Fab 2d12.5
    complexed with cl, dof, gd3, nag

Details for d1nc4d2

PDB Entry: 1nc4 (more details), 2.25 Å

PDB Description: crystal structure of monoclonal antibody 2d12.5 fab complexed with gd- dota
PDB Compounds: (D:) monoclonal antibody 2d12.5, igg1 gamma heavy chain

SCOP Domain Sequences for d1nc4d2:

Sequence, based on SEQRES records: (download)

>d1nc4d2 b.1.1.2 (D:121-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd

Sequence, based on observed residues (ATOM records): (download)

>d1nc4d2 b.1.1.2 (D:121-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
kttppsvyplapgssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
svtvpsstwpsetvtcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d1nc4d2:

Click to download the PDB-style file with coordinates for d1nc4d2.
(The format of our PDB-style files is described here.)

Timeline for d1nc4d2: