SCOP 1.71: Domain d1nc4d2: 1nc4 D:121-220

Lineage for d1nc4d2 (1nc4 D:121-220)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)

8. Domain d1nc4d2: 1nc4 D:121-220 [91796]
   Other proteins in same PDB: d1nc4a1, d1nc4a2, d1nc4b1, d1nc4c1, d1nc4c2, d1nc4d1
   part of Fab 2d12.5
   complexed with cl, dof, gd3, nag

Details for d1nc4d2

PDB Entry: 1nc4, 2.25 Å

PDB Description: crystal structure of monoclonal antibody 2d12.5 fab complexed with gd- dota

SCOP Domain Sequences for d1nc4d2:

Sequence, based on SEQRES records:

>d1nc4d2 b.1.1.2 (D:121-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd

Sequence, based on observed residues (ATOM records):

>d1nc4d2 b.1.1.2 (D:121-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
kttppsvyplapgssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
svtvpsstwpsetvtcnvahpasstkvdkkivprd

Timeline for d1nc4d2:

• d1nc4d2 first appeared in SCOP 1.67
  
• d1nc4d2 appears in SCOP 1.69
  
• d1nc4d2 appears in SCOP 1.73
  
• d1nc4d2 appears in the current release, SCOPe 2.08