![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries) |
![]() | Domain d1nc4c2: 1nc4 C:111-215 [91794] Other proteins in same PDB: d1nc4a1, d1nc4b1, d1nc4b2, d1nc4c1, d1nc4d1, d1nc4d2 part of Fab 2d12.5 complexed with cl, dof, gd3, nag |
PDB Entry: 1nc4 (more details), 2.25 Å
SCOPe Domain Sequences for d1nc4c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nc4c2 b.1.1.2 (C:111-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq snnkymassyltltarawerhssyscqvtheghtvekslspaecs
Timeline for d1nc4c2: