Lineage for d1nc4c2 (1nc4 C:111-215)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 550231Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 550235Species Human (Homo sapiens) [TaxId:9606] [88572] (42 PDB entries)
  8. 550255Domain d1nc4c2: 1nc4 C:111-215 [91794]
    Other proteins in same PDB: d1nc4a1, d1nc4b1, d1nc4b2, d1nc4c1, d1nc4d1, d1nc4d2
    part of Fab 2d12.5
    complexed with cl, dof, gd3, nag

Details for d1nc4c2

PDB Entry: 1nc4 (more details), 2.25 Å

PDB Description: crystal structure of monoclonal antibody 2d12.5 fab complexed with gd- dota

SCOP Domain Sequences for d1nc4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nc4c2 b.1.1.2 (C:111-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens)}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtvekslspaecs

SCOP Domain Coordinates for d1nc4c2:

Click to download the PDB-style file with coordinates for d1nc4c2.
(The format of our PDB-style files is described here.)

Timeline for d1nc4c2: