SCOPe 2.03: Domain d1nc4c1: 1nc4 C:1-110

Lineage for d1nc4c1 (1nc4 C:1-110)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Mouse (Mus musculus) [TaxId:10090] [88541] (34 PDB entries)

8. Domain d1nc4c1: 1nc4 C:1-110 [91793]
   Other proteins in same PDB: d1nc4a2, d1nc4b1, d1nc4b2, d1nc4c2, d1nc4d1, d1nc4d2
   part of Fab 2d12.5
   complexed with cl, dof, gd3, nag

Details for d1nc4c1

PDB Entry: 1nc4, 2.25 Å

PDB Description: crystal structure of monoclonal antibody 2d12.5 fab complexed with gd- dota

PDB Compounds: (C:) monoclonal antibody 2d12.5, lambda light chain

SCOPe Domain Sequences for d1nc4c1:

Sequence; same for both SEQRES and ATOM records:

>d1nc4c1 b.1.1.1 (C:1-110) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggnnnrppgv
parfsgsligdkaaltiagtqtedeaiyfcalwysnhwvfgggtrltvlg

Timeline for d1nc4c1:

• d1nc4c1 first appeared in SCOP 1.67
  
• d1nc4c1 appears in SCOPe 2.02
  
• d1nc4c1 appears in SCOPe 2.04
  
• d1nc4c1 appears in the current release, SCOPe 2.08