SCOP 1.67: Domain d1nc4a2: 1nc4 A:111-211

Lineage for d1nc4a2 (1nc4 A:111-211)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88572] (42 PDB entries)

8. Domain d1nc4a2: 1nc4 A:111-211 [91790]
   Other proteins in same PDB: d1nc4a1, d1nc4b1, d1nc4b2, d1nc4c1, d1nc4d1, d1nc4d2

Details for d1nc4a2

PDB Entry: 1nc4, 2.25 Å

PDB Description: crystal structure of monoclonal antibody 2d12.5 fab complexed with gd- dota

SCOP Domain Sequences for d1nc4a2:

Sequence; same for both SEQRES and ATOM records:

>d1nc4a2 b.1.1.2 (A:111-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens)}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtvekslsp

Timeline for d1nc4a2:

• d1nc4a2 is new in SCOP 1.67
  
• d1nc4a2 appears in SCOP 1.69
  
• d1nc4a2 appears in the current release, SCOPe 2.08