SCOP 1.73: Domain d1nc2d2: 1nc2 D:121-221

Lineage for d1nc2d2 (1nc2 D:121-221)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1nc2d2: 1nc2 D:121-221 [91788]
   Other proteins in same PDB: d1nc2a1, d1nc2a2, d1nc2b1, d1nc2c1, d1nc2c2, d1nc2d1
   part of Fab 2d12.5
   complexed with cl, doe, nag, yt3

Details for d1nc2d2

PDB Entry: 1nc2, 2.1 Å

PDB Description: crystal structure of monoclonal antibody 2d12.5 fab complexed with y- dota

PDB Compounds: (D:) monoclonal antibody 2d12.5, igg1 gamma heavy chain

SCOP Domain Sequences for d1nc2d2:

Sequence, based on SEQRES records:

>d1nc2d2 b.1.1.2 (D:121-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Sequence, based on observed residues (ATOM records):

>d1nc2d2 b.1.1.2 (D:121-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
kttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
vtvpsstwpsetvtcnvahpasstkvdkkivprdc

Timeline for d1nc2d2:

• d1nc2d2 first appeared in SCOP 1.67
  
• d1nc2d2 appears in SCOP 1.71
  
• d1nc2d2 appears in SCOP 1.75
  
• d1nc2d2 appears in the current release, SCOPe 2.08