Lineage for d1nc2d1 (1nc2 D:1-120)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652810Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (36 PDB entries)
  8. 652833Domain d1nc2d1: 1nc2 D:1-120 [91787]
    Other proteins in same PDB: d1nc2a1, d1nc2a2, d1nc2b2, d1nc2c1, d1nc2c2, d1nc2d2
    part of Fab 2d12.5
    complexed with cl, doe, nag, yt3

Details for d1nc2d1

PDB Entry: 1nc2 (more details), 2.1 Å

PDB Description: crystal structure of monoclonal antibody 2d12.5 fab complexed with y- dota
PDB Compounds: (D:) monoclonal antibody 2d12.5, igg1 gamma heavy chain

SCOP Domain Sequences for d1nc2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nc2d1 b.1.1.1 (D:1-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]}
qvklqesgpglvqpsqslsitctvsgfsltdygvhwvrqspgkglewlgviwsgggtayt
aafisrlniykdnsknqvffemnslqandtamyycarrgsypynyfdvwgqgttvtvssa

SCOP Domain Coordinates for d1nc2d1:

Click to download the PDB-style file with coordinates for d1nc2d1.
(The format of our PDB-style files is described here.)

Timeline for d1nc2d1: