Lineage for d1nc2c2 (1nc2 C:111-215)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1109002Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 1109006Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)
  8. 1109020Domain d1nc2c2: 1nc2 C:111-215 [91786]
    Other proteins in same PDB: d1nc2a1, d1nc2b1, d1nc2b2, d1nc2c1, d1nc2d1, d1nc2d2
    part of Fab 2d12.5
    complexed with cl, doe, nag, yt3

Details for d1nc2c2

PDB Entry: 1nc2 (more details), 2.1 Å

PDB Description: crystal structure of monoclonal antibody 2d12.5 fab complexed with y- dota
PDB Compounds: (C:) monoclonal antibody 2d12.5, lambda light chain

SCOPe Domain Sequences for d1nc2c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nc2c2 b.1.1.2 (C:111-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtvekslspaecs

SCOPe Domain Coordinates for d1nc2c2:

Click to download the PDB-style file with coordinates for d1nc2c2.
(The format of our PDB-style files is described here.)

Timeline for d1nc2c2: