| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88572] (43 PDB entries) |
| Domain d1nc2c2: 1nc2 C:111-215 [91786] Other proteins in same PDB: d1nc2a1, d1nc2b1, d1nc2b2, d1nc2c1, d1nc2d1, d1nc2d2 part of Fab 2d12.5 complexed with cl, doe, nag, yt3 |
PDB Entry: 1nc2 (more details), 2.1 Å
SCOP Domain Sequences for d1nc2c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nc2c2 b.1.1.2 (C:111-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtvekslspaecs
Timeline for d1nc2c2: