Lineage for d1nc2b2 (1nc2 B:121-219)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358964Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2359291Species Mouse (Mus musculus) [TaxId:10090] [88576] (429 PDB entries)
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
  8. 2359426Domain d1nc2b2: 1nc2 B:121-219 [91784]
    Other proteins in same PDB: d1nc2a1, d1nc2a2, d1nc2b1, d1nc2c1, d1nc2c2, d1nc2d1
    part of Fab 2d12.5
    complexed with cl, doe, nag, yt3

Details for d1nc2b2

PDB Entry: 1nc2 (more details), 2.1 Å

PDB Description: crystal structure of monoclonal antibody 2d12.5 fab complexed with y- dota
PDB Compounds: (B:) monoclonal antibody 2d12.5, igg1 gamma heavy chain

SCOPe Domain Sequences for d1nc2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nc2b2 b.1.1.2 (B:121-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d1nc2b2:

Click to download the PDB-style file with coordinates for d1nc2b2.
(The format of our PDB-style files is described here.)

Timeline for d1nc2b2: