| Class b: All beta proteins [48724] (141 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries) |
| Domain d1nc2b2: 1nc2 B:121-219 [91784] Other proteins in same PDB: d1nc2a1, d1nc2a2, d1nc2b1, d1nc2c1, d1nc2c2, d1nc2d1 |
PDB Entry: 1nc2 (more details), 2.1 Å
SCOP Domain Sequences for d1nc2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nc2b2 b.1.1.2 (B:121-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
Timeline for d1nc2b2: