SCOP 1.73: Domain d1nc2a2: 1nc2 A:111-211

Lineage for d1nc2a2 (1nc2 A:111-211)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88572] (43 PDB entries)

8. Domain d1nc2a2: 1nc2 A:111-211 [91782]
   Other proteins in same PDB: d1nc2a1, d1nc2b1, d1nc2b2, d1nc2c1, d1nc2d1, d1nc2d2

Details for d1nc2a2

PDB Entry: 1nc2, 2.1 Å

PDB Description: crystal structure of monoclonal antibody 2d12.5 fab complexed with y- dota

PDB Compounds: (A:) monoclonal antibody 2d12.5, lambda light chain

SCOP Domain Sequences for d1nc2a2:

Sequence; same for both SEQRES and ATOM records:

>d1nc2a2 b.1.1.2 (A:111-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtvekslsp

Timeline for d1nc2a2:

• d1nc2a2 first appeared in SCOP 1.67
  
• d1nc2a2 appears in SCOP 1.71
  
• d1nc2a2 appears in SCOP 1.75
  
• d1nc2a2 appears in the current release, SCOPe 2.08