Lineage for d1nakl2 (1nak L:108-212)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656429Domain d1nakl2: 1nak L:108-212 [91758]
    Other proteins in same PDB: d1nakh1, d1nakh2, d1naki1, d1naki2, d1nakl1, d1nakm1

Details for d1nakl2

PDB Entry: 1nak (more details), 2.57 Å

PDB Description: igg1 fab fragment (83.1) complex with 16-residue peptide (residues 304-321 of hiv-1 gp120 (mn isolate))
PDB Compounds: (L:) Fab 83.1 - light chain

SCOP Domain Sequences for d1nakl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nakl2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOP Domain Coordinates for d1nakl2:

Click to download the PDB-style file with coordinates for d1nakl2.
(The format of our PDB-style files is described here.)

Timeline for d1nakl2: