Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) |
Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
Protein Lysyl oxidase PplO, domains 1 and 2 [102806] (1 species) |
Species Yeast (Pichia pastoris) [TaxId:4922] [102807] (1 PDB entry) |
Domain d1n9ea3: 1n9e A:170-315 [91710] Other proteins in same PDB: d1n9ea1, d1n9eb1, d1n9ec1, d1n9ed1 |
PDB Entry: 1n9e (more details), 1.65 Å
SCOP Domain Sequences for d1n9ea3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n9ea3 d.17.2.1 (A:170-315) Lysyl oxidase PplO, domains 1 and 2 {Yeast (Pichia pastoris)} evghldriksaakssflnknlnttimrdvlegligvpyedmgchsaapqlhdpatgatvd ygtcnintendaenlvptgfffkfdmtgrdvsqwkmleyiynnkvytsaeelyeamqkdd fvtlpkidvdnldwtviqrndsapir
Timeline for d1n9ea3: