Lineage for d1n4ta_ (1n4t A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 605295Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 605296Superfamily d.61.1: LigT-like [55144] (3 families) (S)
  5. 605310Family d.61.1.3: 2',3'-cyclic nucleotide 3'-phosphodiesterase, catalytic domain [103043] (1 protein)
  6. 605311Protein 2',3'-cyclic nucleotide 3'-phosphodiesterase, catalytic domain [103044] (1 species)
  7. 605312Species Rat (Rattus norvegicus) [TaxId:10116] [103045] (1 PDB entry)
  8. 605313Domain d1n4ta_: 1n4t A: [91671]

Details for d1n4ta_

PDB Entry: 1n4t (more details)

PDB Description: Solution structure of the catalytic domain from rat CNP

SCOP Domain Sequences for d1n4ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4ta_ d.61.1.3 (A:) 2',3'-cyclic nucleotide 3'-phosphodiesterase, catalytic domain {Rat (Rattus norvegicus)}
gshmflplyfgwfltkkssetlrkagqvfleelgnhkafkkelrhfisgdepkekldlvs
yfgkrppgvlhcttkfcdygkatgaeeyaqqdvvrrsygkafklsisalfvtpktagaqv
vlneqelqlwpsdldkpssseslppgsrahvtlgcaadvqpvqtgldlleilqqvkggsq
geevgelprgklyslgkgrwmlslakkmevkaiftgyyg

SCOP Domain Coordinates for d1n4ta_:

Click to download the PDB-style file with coordinates for d1n4ta_.
(The format of our PDB-style files is described here.)

Timeline for d1n4ta_: