Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
Protein beta-Lactamase, class A [56606] (16 species) |
Species Stenotrophomonas maltophilia, L2 [TaxId:40324] [103374] (2 PDB entries) |
Domain d1n4ob_: 1n4o B: [91622] complexed with so4 |
PDB Entry: 1n4o (more details), 1.85 Å
SCOPe Domain Sequences for d1n4ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n4ob_ e.3.1.1 (B:) beta-Lactamase, class A {Stenotrophomonas maltophilia, L2 [TaxId: 40324]} tanaptdaaitaasdfaalekacagrlgvtlldtasgrrighrqderfpmcstfksmlaa tvlsqaermpalldrrvpvgeadllshapvtrrhagkdmtvrdlcratiitsdntaanll fgvvggppavtaflrasgdtvsrsdrlepelnsfakgdprdtttpaamaatlqrvvlgev lqpasrqqladwlidnetgdaclraglgkrwrvgdktgsngedarndiavlwpvaggapw vltaylqagaisyeqrasvlaqvgriadrlig
Timeline for d1n4ob_: