Lineage for d1n4ob_ (1n4o B:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949540Protein beta-Lactamase, class A [56606] (16 species)
  7. 1949743Species Stenotrophomonas maltophilia, L2 [TaxId:40324] [103374] (2 PDB entries)
  8. 1949747Domain d1n4ob_: 1n4o B: [91622]
    complexed with so4

Details for d1n4ob_

PDB Entry: 1n4o (more details), 1.85 Å

PDB Description: Crystal structure of the Class A beta-lactamase L2 from Stenotrophomonas maltophilia
PDB Compounds: (B:) L2 beta-lactamase

SCOPe Domain Sequences for d1n4ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4ob_ e.3.1.1 (B:) beta-Lactamase, class A {Stenotrophomonas maltophilia, L2 [TaxId: 40324]}
tanaptdaaitaasdfaalekacagrlgvtlldtasgrrighrqderfpmcstfksmlaa
tvlsqaermpalldrrvpvgeadllshapvtrrhagkdmtvrdlcratiitsdntaanll
fgvvggppavtaflrasgdtvsrsdrlepelnsfakgdprdtttpaamaatlqrvvlgev
lqpasrqqladwlidnetgdaclraglgkrwrvgdktgsngedarndiavlwpvaggapw
vltaylqagaisyeqrasvlaqvgriadrlig

SCOPe Domain Coordinates for d1n4ob_:

Click to download the PDB-style file with coordinates for d1n4ob_.
(The format of our PDB-style files is described here.)

Timeline for d1n4ob_: