Lineage for d1n2ra2 (1n2r A:1-181)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1020887Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1021081Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (12 PDB entries)
    Uniprot P30481 25-300
  8. 1021086Domain d1n2ra2: 1n2r A:1-181 [91562]
    Other proteins in same PDB: d1n2ra1, d1n2rb_
    complexed with acy

Details for d1n2ra2

PDB Entry: 1n2r (more details), 1.7 Å

PDB Description: A natural selected dimorphism in HLA B*44 alters self, peptide reportoire and T cell recognition.
PDB Compounds: (A:) HLA class I histocompatibility antigen, BW-44(B-12) B*4403 alpha chain

SCOPe Domain Sequences for d1n2ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n2ra2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfitvgyvddtlfvrfdsdatsprkeprapwieqegpeyw
dretqisktntqtyrenlrtalryynqseagshiiqrmygcdvgpdgrllrgydqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcveslrrylengketlq
r

SCOPe Domain Coordinates for d1n2ra2:

Click to download the PDB-style file with coordinates for d1n2ra2.
(The format of our PDB-style files is described here.)

Timeline for d1n2ra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n2ra1
View in 3D
Domains from other chains:
(mouse over for more information)
d1n2rb_