SCOPe 2.05: Domain d1n2ab2: 1n2a B:1-80

Lineage for d1n2ab2 (1n2a B:1-80)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class beta GST [81368] (4 species)

7. Species Escherichia coli [TaxId:562] [52883] (3 PDB entries)

8. Domain d1n2ab2: 1n2a B:1-80 [91556]
   Other proteins in same PDB: d1n2aa1, d1n2ab1
   complexed with gts

Details for d1n2ab2

PDB Entry: 1n2a, 1.9 Å

PDB Description: Crystal Structure of a Bacterial Glutathione Transferase from Escherichia coli with Glutathione Sulfonate in the Active Site

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d1n2ab2:

Sequence, based on SEQRES records:

>d1n2ab2 c.47.1.5 (B:1-80) Class beta GST {Escherichia coli [TaxId: 562]}
mklfykpgacslashitlresgkdftlvsvdlmkkrlengddyfavnpkgqvpalllddg
tlltegvaimqyladsvpdr

Sequence, based on observed residues (ATOM records):

>d1n2ab2 c.47.1.5 (B:1-80) Class beta GST {Escherichia coli [TaxId: 562]}
mklfykpgacslashitlresgkdftlvsvdyfavnpkgqvpalllddgtlltegvaimq
yladsvpdr

Timeline for d1n2ab2:

• d1n2ab2 first appeared in SCOP 1.67
  
• d1n2ab2 appears in SCOPe 2.04
  
• d1n2ab2 appears in SCOPe 2.06
  
• d1n2ab2 appears in the current release, SCOPe 2.08