Lineage for d1n2aa1 (1n2a A:81-201)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355982Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 355983Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 355984Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 356068Protein Class beta GST [81357] (3 species)
  7. 356069Species Escherichia coli [TaxId:562] [47638] (3 PDB entries)
  8. 356070Domain d1n2aa1: 1n2a A:81-201 [91553]
    Other proteins in same PDB: d1n2aa2, d1n2ab2

Details for d1n2aa1

PDB Entry: 1n2a (more details), 1.9 Å

PDB Description: Crystal Structure of a Bacterial Glutathione Transferase from Escherichia coli with Glutathione Sulfonate in the Active Site

SCOP Domain Sequences for d1n2aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli}
qllapvnsisryktiewlnyiatelhkgftplfrpdtpeeykptvraqlekklqyvneal
kdehwicgqrftiadaylftvlrwayavklnleglehiaafmqrmaerpevqdalsaegl
k

SCOP Domain Coordinates for d1n2aa1:

Click to download the PDB-style file with coordinates for d1n2aa1.
(The format of our PDB-style files is described here.)

Timeline for d1n2aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n2aa2