SCOPe 2.08: Domain d1n28a_: 1n28 A:

Lineage for d1n28a_ (1n28 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Phospholipase A2 [48637] (5 species)

7. Species Human (Homo sapiens), synovial fluid [TaxId:9606] [48638] (16 PDB entries)

8. Domain d1n28a_: 1n28 A: [91550]
   complexed with ca; mutant

Details for d1n28a_

PDB Entry: 1n28, 1.5 Å

PDB Description: crystal structure of the h48q mutant of human group iia phospholipase a2

PDB Compounds: (A:) Phospholipase A2, membrane associated

SCOPe Domain Sequences for d1n28a_:

Sequence; same for both SEQRES and ATOM records:

>d1n28a_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), synovial fluid [TaxId: 9606]}
alvnfhrmiklttgkeaalsygfygchcgvggrgspkdatdrccvtqdccykrlekrgcg
tkflsykfsnsgsritcakqdscrsqlcecdkaaatcfarnkttynkkyqyysnkhcrgs
tprc

Timeline for d1n28a_:

• d1n28a_ first appeared in SCOP 1.67
  
• d1n28a_ appears in SCOPe 2.07