Lineage for d1n1l.2 (1n1l B:,D:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 671537Family b.47.1.3: Viral proteases [50596] (4 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 671538Protein NS3 protease [50600] (3 species)
  7. 671544Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (14 PDB entries)
  8. 671552Domain d1n1l.2: 1n1l B:,D: [91545]
    complexed with trl, zn; mutant

Details for d1n1l.2

PDB Entry: 1n1l (more details), 2.6 Å

PDB Description: crystal structure of hcv ns3 protease domain:ns4a peptide complex with covalently bound inhibitor (gw472467x)
PDB Compounds: (B:) hcv ns3 serine protease, (D:) ns4a cofactor

SCOP Domain Sequences for d1n1l.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1n1l.2 b.47.1.3 (B:,D:) NS3 protease {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
qvegevqivstatqtflatcingvcwtvyhgagtrtiaspkgpviqmytnvdqdlvgwpa
pqgsrsltpctcgssdlylvtrhadvipvrrrgdsrgsllsprpisylkgssggpllcpa
ghavglfraavctrgvtkavdfipvenlettmrXgsvvivgrivlsgkpa

SCOP Domain Coordinates for d1n1l.2:

Click to download the PDB-style file with coordinates for d1n1l.2.
(The format of our PDB-style files is described here.)

Timeline for d1n1l.2: