SCOP 1.67: Domain d1n1l.1: 1n1l A:,C:

Lineage for d1n1l.1 (1n1l A:,C:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.3: Viral proteases [50596] (4 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein NS3 protease [50600] (2 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (11 PDB entries)

8. Domain d1n1l.1: 1n1l A:,C: [91544]

Details for d1n1l.1

PDB Entry: 1n1l, 2.6 Å

PDB Description: crystal structure of hcv ns3 protease domain:ns4a peptide complex with covalently bound inhibitor (gw472467x)

SCOP Domain Sequences for d1n1l.1:

Sequence; same for both SEQRES and ATOM records:

>g1n1l.1 b.47.1.3 (A:,C:) NS3 protease {Human hepatitis C virus (HCV), different isolates}
apitayaqqtrgllgciitsltgrdknqvegevqivstatqtflatcingvcwtvyhgag
trtiaspkgpviqmytnvdqdlvgwpapqgsrsltpctcgssdlylvtrhadvipvrrrg
dsrgsllsprpisylkgssggpllcpaghavglfraavctrgvtkavdfipvenlettmr
Xkgsvvivgrivlsgkpaiipk

Timeline for d1n1l.1:

• d1n1l.1 is new in SCOP 1.67
  
• d1n1l.1 appears in SCOP 1.69
  
• d1n1l.1 appears in the current release, SCOPe 2.08