Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) |
Family c.26.1.2: Cytidylyltransferase [52394] (1 protein) |
Protein CTP:glycerol-3-phosphate cytidylyltransferase [52395] (1 species) |
Species Bacillus subtilis [TaxId:1423] [52396] (2 PDB entries) |
Domain d1n1dd_: 1n1d D: [91541] |
PDB Entry: 1n1d (more details), 2 Å
SCOP Domain Sequences for d1n1dd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n1dd_ c.26.1.2 (D:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis} mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt kikeei
Timeline for d1n1dd_: