Lineage for d1n1dd_ (1n1d D:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 392101Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 392102Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 392241Family c.26.1.2: Cytidylyltransferase [52394] (1 protein)
  6. 392242Protein CTP:glycerol-3-phosphate cytidylyltransferase [52395] (1 species)
  7. 392243Species Bacillus subtilis [TaxId:1423] [52396] (2 PDB entries)
  8. 392249Domain d1n1dd_: 1n1d D: [91541]
    complexed with c2g, so4

Details for d1n1dd_

PDB Entry: 1n1d (more details), 2 Å

PDB Description: Glycerol-3-phosphate cytidylyltransferase complexed with CDP-glycerol

SCOP Domain Sequences for d1n1dd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n1dd_ c.26.1.2 (D:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis}
mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile
tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt
kikeei

SCOP Domain Coordinates for d1n1dd_:

Click to download the PDB-style file with coordinates for d1n1dd_.
(The format of our PDB-style files is described here.)

Timeline for d1n1dd_: