Lineage for d1n0yb_ (1n0y B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355182Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 355183Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 355357Family a.39.1.5: Calmodulin-like [47502] (21 proteins)
    Duplication: made with two pairs of EF-hands
  6. 355393Protein Calmodulin [47516] (9 species)
  7. 355411Species Ciliate (Paramecium tetraurelia) [TaxId:5888] [47523] (4 PDB entries)
  8. 355415Domain d1n0yb_: 1n0y B: [91537]
    complexed with act, cac, pb

Details for d1n0yb_

PDB Entry: 1n0y (more details), 1.75 Å

PDB Description: crystal structure of pb-bound calmodulin

SCOP Domain Sequences for d1n0yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0yb_ a.39.1.5 (B:) Calmodulin {Ciliate (Paramecium tetraurelia)}
lslmarkmkeqdseeelieafkvfdrdgnglisaaelrhvmtnlgekltddevdemirea
didgdghinyeefvrmmvs

SCOP Domain Coordinates for d1n0yb_:

Click to download the PDB-style file with coordinates for d1n0yb_.
(The format of our PDB-style files is described here.)

Timeline for d1n0yb_: