Lineage for d1n0xm2 (1n0x M:108-214)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1516253Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1516254Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 1516264Domain d1n0xm2: 1n0x M:108-214 [91535]
    Other proteins in same PDB: d1n0xh1, d1n0xh2, d1n0xk1, d1n0xk2, d1n0xl1, d1n0xm1
    part of an anti HIV-1 Fab
    complexed with cxs, gol, k, so4

Details for d1n0xm2

PDB Entry: 1n0x (more details), 1.8 Å

PDB Description: crystal structure of a broadly neutralizing anti-hiv-1 antibody in complex with a peptide mimotope
PDB Compounds: (M:) immunoglobulin light chain

SCOPe Domain Sequences for d1n0xm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0xm2 b.1.1.2 (M:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglrspvtksfnrgec

SCOPe Domain Coordinates for d1n0xm2:

Click to download the PDB-style file with coordinates for d1n0xm2.
(The format of our PDB-style files is described here.)

Timeline for d1n0xm2: