Lineage for d1n0xl1 (1n0x L:1-107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2353665Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353813Species Human (Homo sapiens), cluster 3.1 [TaxId:9606] [88522] (8 PDB entries)
  8. 2353817Domain d1n0xl1: 1n0x L:1-107 [91532]
    Other proteins in same PDB: d1n0xh1, d1n0xh2, d1n0xk1, d1n0xk2, d1n0xl2, d1n0xm2
    part of an anti HIV-1 Fab
    complexed with cxs, gol, k, so4

Details for d1n0xl1

PDB Entry: 1n0x (more details), 1.8 Å

PDB Description: crystal structure of a broadly neutralizing anti-hiv-1 antibody in complex with a peptide mimotope
PDB Compounds: (L:) immunoglobulin light chain

SCOPe Domain Sequences for d1n0xl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0xl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.1 [TaxId: 9606]}
eivltqspgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsnrasgis
drfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerk

SCOPe Domain Coordinates for d1n0xl1:

Click to download the PDB-style file with coordinates for d1n0xl1.
(The format of our PDB-style files is described here.)

Timeline for d1n0xl1: