SCOPe 2.03: Domain d1n0xl1: 1n0x L:1-107

Lineage for d1n0xl1 (1n0x L:1-107)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3.1 [TaxId:9606] [88522] (8 PDB entries)

8. Domain d1n0xl1: 1n0x L:1-107 [91532]
   Other proteins in same PDB: d1n0xh1, d1n0xh2, d1n0xk1, d1n0xk2, d1n0xl2, d1n0xm2
   part of an anti HIV-1 Fab
   complexed with cxs, gol, k, so4

Details for d1n0xl1

PDB Entry: 1n0x, 1.8 Å

PDB Description: crystal structure of a broadly neutralizing anti-hiv-1 antibody in complex with a peptide mimotope

PDB Compounds: (L:) immunoglobulin light chain

SCOPe Domain Sequences for d1n0xl1:

Sequence; same for both SEQRES and ATOM records:

>d1n0xl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.1 [TaxId: 9606]}
eivltqspgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsnrasgis
drfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerk

Timeline for d1n0xl1:

• d1n0xl1 first appeared in SCOP 1.67
  
• d1n0xl1 appears in SCOPe 2.02
  
• d1n0xl1 appears in SCOPe 2.04
  
• d1n0xl1 appears in the current release, SCOPe 2.08