SCOP 1.75: Domain d1n0xh2: 1n0x H:114-228

Lineage for d1n0xh2 (1n0x H:114-228)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
   SQ NA # humanized antibody
   Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region
   SQ NA # engineered antibody
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d1n0xh2: 1n0x H:114-228 [91529]
   Other proteins in same PDB: d1n0xh1, d1n0xk1, d1n0xl1, d1n0xl2, d1n0xm1, d1n0xm2
   part of an anti HIV-1 Fab

Details for d1n0xh2

PDB Entry: 1n0x, 1.8 Å

PDB Description: crystal structure of a broadly neutralizing anti-hiv-1 antibody in complex with a peptide mimotope

PDB Compounds: (H:) immunoglobulin heavy chain

SCOP Domain Sequences for d1n0xh2:

Sequence, based on SEQRES records:

>d1n0xh2 b.1.1.2 (H:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records):

>d1n0xh2 b.1.1.2 (H:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d1n0xh2:

• d1n0xh2 first appeared in SCOP 1.67
  
• d1n0xh2 appears in SCOP 1.73
  
• d1n0xh2 appears in SCOPe 2.01
  
• d1n0xh2 appears in the current release, SCOPe 2.08